PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015564
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 195aa    MW: 21102.1 Da    PI: 5.601
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015564genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42371361100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la+++
  DCAR_015564  37 PCAACKILRRRCAEKCVLAPYFPPTDPLKFTTAHRVFGASNIIKFLQELPEHQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVNELQAHLAKAQ 134
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  DCAR_015564 135 AE 136
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01136137IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4237134IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDGASKAASI LMPPPKAVAA TPSIAPSSPP VSLVVSPCAA CKILRRRCAE KCVLAPYFPP  60
TDPLKFTTAH RVFGASNIIK FLQELPEHQR ADAVSSMVYE ANARIRDPVY GCAGAICQLQ  120
KQVNELQAHL AKAQAEVVTM QCQYSNLMTL ISMDFDHSPQ SSPDQQSFDN LSTNDISFFD  180
DNNLGSLELD SLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343464.17e-90PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM1CDT57e-90M1CDT5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000653462e-89(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-67LOB domain-containing protein 1